DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Muc18B and LEO1

DIOPT Version :9

Sequence 1:NP_001285431.1 Gene:Muc18B / 32913 FlyBaseID:FBgn0031000 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001310832.1 Gene:LEO1 / 123169 HGNCID:30401 Length:688 Species:Homo sapiens


Alignment Length:207 Identity:45/207 - (21%)
Similarity:75/207 - (36%) Gaps:45/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EARDDSNIENPTIPPSNLDESTTEKPATEAPGTTEKVTTAAPGTTEKVTTEAPGTTEKITT--EA 141
            ||.:.|:.|:.  .||::|:.:    .:|||...|.....:.|.:..  :||.| :||..:  |.
Human    89 EASERSDHEDN--DPSDVDQHS----GSEAPNDDEDEGHRSDGGSHH--SEAEG-SEKAHSDDEK 144

  Fly   142 PGTTEKITTEAPGTTEKITT-----EAPGTTEKITTEAPGTTEKPATD----------------- 184
            .|..:|   ......|||..     .|.|:.|.....:....:...||                 
Human   145 WGREDK---SDQSDDEKIQNSDDEERAQGSDEDKLQNSDDDEKMQNTDDEERPQLSDDERQQLSE 206

  Fly   185 ---APGTTEKP-ATDAPGTTEKSETTDAPGTTDK-----SDTDAPITDEPSTAETSTDEPNTETT 240
               |....|:| |:|.....:.|:..:.|..:|:     ||.:.|...:.....:..:|.....:
Human   207 EEKANSDDERPVASDNDDEKQNSDDEEQPQLSDEEKMQNSDDERPQASDEEHRHSDDEEEQDHKS 271

  Fly   241 ESGEETTIEDNV 252
            ||...:..||.|
Human   272 ESARGSDSEDEV 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Muc18BNP_001285431.1 CBM_14 26..72 CDD:279884
MCLC <77..177 CDD:283562 26/104 (25%)
LEO1NP_001310832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..357 45/207 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 547..583
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.