DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and LOC4577831

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:XP_001230818.1 Gene:LOC4577831 / 4577831 VectorBaseID:AGAMI1_006688 Length:263 Species:Anopheles gambiae


Alignment Length:143 Identity:39/143 - (27%)
Similarity:53/143 - (37%) Gaps:26/143 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 EETSSAPAEPESSSTSSAASPSTPAGTTIAPTPPTFKCQTAGLFPHISGDCSRYHNCLLNPVLRQ 307
            |.|:|....|..|.....::.|.|           |.|..:||||. ..:|..||.||    ...
Mosquito    78 EGTASDRCGPTPSDVCVTSTESRP-----------FTCSASGLFPD-PNNCQNYHVCL----AAS 126

  Fly   308 LQDIELTCPELTVFSPSLGRCVRDL--AECQVESFPCLSVGRFA--GIDETYYYSCVASLQG-GF 367
            ......|||...||:.....|:|.:  |.|...|.| ::|..:.  |....||..|    .| ..
Mosquito   127 ESSTVYTCPPGYVFNIVTTSCIRQISAANCVTVSCP-VAVPSYVLYGTSRVYYVVC----DGVNL 186

  Fly   368 HKFIVRCSSGQRF 380
            ...::||.:|..|
Mosquito   187 PTEVLRCPNGALF 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616 3/5 (60%)
ChtBD2 278..329 CDD:214696 16/50 (32%)
LOC4577831XP_001230818.1 CBM_14 108..156 CDD:426342 17/52 (33%)
ChtBD2 219..260 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.