DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and Gasp

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_649611.2 Gene:Gasp / 40745 FlyBaseID:FBgn0026077 Length:258 Species:Drosophila melanogaster


Alignment Length:93 Identity:28/93 - (30%)
Similarity:35/93 - (37%) Gaps:23/93 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 PESSSTSSAASPSTPAGTTIAPTPPTFKCQTAGLFPHIS--GDCSRYHNCLLNPVLRQLQDIELT 314
            ||..:...|...|.||...:|         .||.|...:  .||.:|:.| |..|.|     |..
  Fly   142 PECKNEEVANGFSCPAAGELA---------NAGSFSRHAHPEDCRKYYIC-LEGVAR-----EYG 191

  Fly   315 CPELTVF----SPSLGRC--VRDLAECQ 336
            ||..|||    |...|.|  ..|:..|:
  Fly   192 CPIGTVFKIGDSDGTGNCEDPEDVPGCE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 19/58 (33%)
GaspNP_649611.2 ChtBD2 21..72 CDD:214696
CBM_14 97..144 CDD:426342 1/1 (100%)
CBM_14 170..218 CDD:426342 17/53 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.