DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and CG17145

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_649192.2 Gene:CG17145 / 40215 FlyBaseID:FBgn0036953 Length:334 Species:Drosophila melanogaster


Alignment Length:136 Identity:36/136 - (26%)
Similarity:61/136 - (44%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 APEETS---SAPAEPESSSTSSAASPSTPAGTTIAPTPPTFK-CQTA--GL-FPHISGDCSRYHN 298
            |.|||:   :.|.|...::|:...|....:..|.:    ||: |...  |: |.::.| |:.||.
  Fly   111 ADEETALYGTCPQETHFNATTQMCSRQHESDCTTS----TFEYCSIVKNGVNFDNLQG-CNMYHV 170

  Fly   299 CLLNPVLRQLQDIELTCPELTVFSPSLGRCV-RDLAECQVESFPCLSVGRFAGIDETYYYSCVAS 362
            | ...||:     :.||.: |.:..|.|.|| :.|.:|.....|....|:.:...|..:.:..|:
  Fly   171 C-EKGVLK-----DKTCSK-TYYQASTGECVSKALVDCDAHPLPTDVCGKASKPYENKFVADEAT 228

  Fly   363 LQGGFH 368
            .:|.|:
  Fly   229 CRGYFY 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616 4/10 (40%)
ChtBD2 278..329 CDD:214696 16/54 (30%)
CG17145NP_649192.2 CBM_14 91..142 CDD:426342 8/30 (27%)
CBM_14 278..327 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.