DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and CG7290

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_649188.1 Gene:CG7290 / 40211 FlyBaseID:FBgn0036949 Length:419 Species:Drosophila melanogaster


Alignment Length:131 Identity:36/131 - (27%)
Similarity:53/131 - (40%) Gaps:24/131 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 AGTTIAPTPPTFKC--QTAGLFPHISGDCSRYHNCLLNPVLRQLQDIELTCPELTVFSPSLGRCV 329
            |...||....|..|  .:.|.:.....|||.|:.|      :......::||:...|..:..:|.
  Fly    19 AAPAIADVNVTALCLLVSNGNYVASQSDCSTYYQC------QGSSFTAMSCPQGYYFDKNAQQCT 77

  Fly   330 RDL-AECQVESFPCL--SVGRFAGIDET---YYYSCVAS--LQGGFHKFIVRCSSGQRFEPLIGG 386
            ..: :.|...|.|||  :||.||....:   ||| |.||  ::|       .|.:|:.|.|....
  Fly    78 GTVPSTCTSNSDPCLGKAVGSFAASSSSCGGYYY-CGASGAVRG-------NCPAGENFNPTTMA 134

  Fly   387 C 387
            |
  Fly   135 C 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 10/52 (19%)
CG7290NP_649188.1 CBM_14 32..77 CDD:426342 10/50 (20%)
CBM_14 91..142 CDD:426342 18/53 (34%)
CBM_14 160..207 CDD:426342
CBM_14 234..277 CDD:426342
ChtBD2 <296..331 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.