DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and obst-F

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:94 Identity:27/94 - (28%)
Similarity:38/94 - (40%) Gaps:22/94 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   236 EQTSSAPEETSSAPAEPESSSTSSAASPSTPAGTTIAPTPPTFKCQTAGLFPHISGDCSRYHNCL 300
            :|..::||.|...|..|          ||.|.....|.|.|:.| |:....|.   |||:|:.|:
  Fly   243 QQFLTSPEITELPPVTP----------PSPPRAEANALTCPSTK-QSYMSHPE---DCSKYYICI 293

  Fly   301 LN-PVLRQLQDIELTCPELTVFSPSLGRC 328
            .. |||       .:||:...:....|.|
  Fly   294 GGMPVL-------TSCPKGLFWDQKSGFC 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616 4/12 (33%)
ChtBD2 278..329 CDD:214696 15/52 (29%)
obst-FNP_649186.1 CBM_14 43..91 CDD:426342
CBM_14 156..198 CDD:426342
CBM_14 272..321 CDD:426342 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.