DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and CG10140

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:145 Identity:35/145 - (24%)
Similarity:52/145 - (35%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 GDCSRYHNCLLNPVLRQLQDIELTCPELTVFSPSLGRCVRD-----LAECQVESFPCLSVGRFAG 350
            |||:||:.|      |..|.|||.|.....|:.:...||..     |..|:..:|...|..|.. 
  Fly    68 GDCNRYYLC------RSGQAIELQCEWPYEFNANTQSCVHPGDADCLPTCEAFNFSTFSYQRTC- 125

  Fly   351 IDETYYYSCVASLQGGFHKFIVR-CSSGQRFEPLIGGCWRYDWTQIVPGQEATEISDLAAIKREL 414
               |.|..|.      :.|.::| |..|.::......|   |:.|           ::..::.|.
  Fly   126 ---TRYVLCY------YGKPVLRQCQDGLQYNSATDRC---DFPQ-----------NVDCVESEC 167

  Fly   415 KLYKAEAKLRLKAQK 429
            .:|.....||....|
  Fly   168 SIYSNAYHLRYVPSK 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 13/37 (35%)
CG10140NP_648648.2 CBM_14 63..106 CDD:426342 15/43 (35%)
CBM_14 111..161 CDD:426342 14/73 (19%)
CBM_14 178..222 CDD:426342 1/5 (20%)
ChtBD2 244..292 CDD:214696
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.