DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and CG5883

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:194 Identity:41/194 - (21%)
Similarity:63/194 - (32%) Gaps:73/194 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 CQTAGLFPHISGDC---------SRYHNCLLNPVLRQLQD---------------IELTCPELTV 320
            |.....|..:|..|         ::|..|.:.||....:|               :|.||.....
  Fly   126 CNLGMYFDQVSKSCVYSEDTVCAAKYEICDVAPVGTPFRDDANCHKYYTCSSKSLVENTCENGLY 190

  Fly   321 FSPSLGRCVR-----------------------------DLAECQVESFPCLSVGRFAGIDET-- 354
            ::.:.|.|||                             |:|.|: ..:.|..:|  :||.:|  
  Fly   191 YNVATGTCVRKKDVICENHPLPDEVCGNKKLAVRNKFVSDMATCR-GYYYCRDLG--SGIPDTDP 252

  Fly   355 YYYSCVAS------LQGGFHKFIVRCS----SGQR--FEPL-IGGCWRYDWTQIVPGQEATEIS 405
            .|..|..:      .|....:...:|.    .|::  ||.. |.||..|  .:.|.|:|.|.||
  Fly   253 IYQQCDENNFFNQERQACMPRESQKCDYDRCDGRKDGFEVAEIDGCHHY--IECVDGRETTPIS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 13/72 (18%)
CG5883NP_648526.2 CBM_14 95..146 CDD:426342 4/19 (21%)
CBM_14 154..204 CDD:426342 11/49 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.