DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mur18B and CG32302

DIOPT Version :10

Sequence 1:NP_573364.1 Gene:Mur18B / 32912 FlyBaseID:FBgn0030999 Length:481 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:109 Identity:36/109 - (33%)
Similarity:45/109 - (41%) Gaps:10/109 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 PTPPTFKCQTAGLFPHISGDCSRYHNCLLNPVLRQLQDIELTCPELTVFSPSLGRCV--RDLAEC 335
            |....|.||.|||||. ..||.|||.|     ..|..|....|.....:|...|.||  |:..:|
  Fly    86 PKRGPFSCQQAGLFPD-PYDCRRYHEC-----SDQSVDTPRICSNGAGYSTLTGTCVLPRESEQC 144

  Fly   336 QVESFPCLSVGRFAG--IDETYYYSCVASLQGGFHKFIVRCSSG 377
            ..|.|.|...|:..|  .|..|:|.||.......:..:::|..|
  Fly   145 IQEQFTCSRSGQVGGWAPDNRYFYVCVNDTANSLYPLMMKCHEG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mur18BNP_573364.1 PTZ00436 <120..249 CDD:185616
ChtBD2 278..329 CDD:214696 19/50 (38%)
CG32302NP_728732.1 CBM_14 94..144 CDD:426342 20/55 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.