DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14195 and SLC16A1

DIOPT Version :10

Sequence 1:NP_728227.1 Gene:CG14195 / 32911 FlyBaseID:FBgn0030998 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_003042.3 Gene:SLC16A1 / 6566 HGNCID:10922 Length:500 Species:Homo sapiens


Alignment Length:167 Identity:36/167 - (21%)
Similarity:65/167 - (38%) Gaps:52/167 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 QRRRVVKKHIQQKYMLCGFAIHAFLATPAYLYGNVVESDKDLVLRIWPAIVYQATGELCRSIMEH 95
            |.:|.|.:.|.|...|..|....||   .||.|||:     :...::..:|:.::          
Human   240 QEKRSVFQTINQFLDLTLFTHRGFL---LYLSGNVI-----MFFGLFAPLVFLSS---------- 286

  Fly    96 LDTEYSGRSRETTQYRRVFLLATLIACVSLMV---SGIL------------FSSAWIVVT----- 140
                 .|:|:..:..:..||| :::|.|.::.   .|::            |.:|.:|..     
Human   287 -----YGKSQHYSSEKSAFLL-SILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHM 345

  Fly   141 ----TTTQVVAIVFYGFFAGIGSSLYLWKTHVILEAV 173
                :||.|...|:.|||    ...:.|.:.|:.|.:
Human   346 LAPLSTTYVGFCVYAGFF----GFAFGWLSSVLFETL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14195NP_728227.1 None
SLC16A1NP_003042.3 2A0113 1..455 CDD:273325 36/167 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 454..500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.