Sequence 1: | NP_573362.1 | Gene: | Ulp1 / 32910 | FlyBaseID: | FBgn0027603 | Length: | 1513 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491952.1 | Gene: | ulp-5 / 186900 | WormBaseID: | WBGene00006740 | Length: | 311 | Species: | Caenorhabditis elegans |
Alignment Length: | 228 | Identity: | 59/228 - (25%) |
---|---|---|---|
Similarity: | 84/228 - (36%) | Gaps: | 78/228 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 1329 DGEWLNDAIINFYMS--MLTERSEK--RAGELPATYAMNTFFMPRL----------------LQA 1373
Fly 1374 GYAGVRRWTRKVDLF-SKDIIPVPVHCGN-VHWCMAIIH----------------LRNKT----- 1415
Fly 1416 -------IFYYDSMGRPNQPALDALV---KYLHEESLDK-RKQPFD------------------M 1451
Fly 1452 TGFVVENAQNIPRQGNSSDCGVFSCMFAEYITR 1484 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ulp1 | NP_573362.1 | Ehrlichia_rpt | 200..>580 | CDD:118064 | |
Peptidase_C48 | 1331..1506 | CDD:280975 | 58/226 (26%) | ||
ulp-5 | NP_491952.1 | Peptidase_C48 | 50..302 | CDD:367240 | 58/224 (26%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5160 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |