DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ulp1 and ulp-4

DIOPT Version :9

Sequence 1:NP_573362.1 Gene:Ulp1 / 32910 FlyBaseID:FBgn0027603 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_495703.2 Gene:ulp-4 / 174307 WormBaseID:WBGene00006739 Length:382 Species:Caenorhabditis elegans


Alignment Length:309 Identity:60/309 - (19%)
Similarity:117/309 - (37%) Gaps:96/309 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly  1231 ESMHL---LGIAEQQANESKDERLAYEK-------KLREVMFRSGAPHRPFFEIGPLEQPEEKKE 1285
            :..||   :|..::.::.|.|:.:.:|:       .:.|.:               :::.||:::
 Worm    45 DGTHLDGSIGEEDETSSGSNDQHMDFEEDDFDMESSMTEDL---------------VDEDEEEED 94

  Fly  1286 TKLIPLTKEDHARFQEMTTIEVTTN--------------LIFKY-NLQITTDDIFTFVDGEWLND 1335
                   :||:   .|.|..:.|.|              :.|.: ::.|...|.....:.:.|||
 Worm    95 -------EEDN---DEWTNQKRTDNQNSVAYYAAMEMLRIRFPFQSIAIRISDFCCLQEKDLLND 149

  Fly  1336 AIINFYMSMLTERSEKRAGELPATYAMNTFFMPRL-------------------------LQAGY 1375
            .:|:||::.:.|.      .||.:...|...:|.:                         :...:
 Worm   150 TMIDFYLNHIVEH------VLPDSNGSNVTVLPSIFWHNLSLRQHAFDSEDEKMMSDEQKMDLKF 208

  Fly  1376 AGVRRWTRKVDLFSKDIIPVPVHCGNVHWCMAII-H---LRNKTIFY-----YDSMGRPNQPAL- 1430
            ..:..:....||...|.|.|||:... ||.:|:| |   .:.:|:.:     .|.....|...| 
 Worm   209 GDLHDFVADFDLQDFDYIVVPVNEWE-HWSLAVICHPFTAQARTVIFDSQLTADLNNLQNMATLI 272

  Fly  1431 DALVKYLHEESLDKRKQPFDMTGFVVENAQNIPRQGNSSDCGVFSCMFA 1479
            ::.:||.:|:... ...||.:...:   .|.:|:|.|:.|||:|...||
 Worm   273 ESFMKYSYEKRTG-NAMPFPLPCIL---PQRMPQQTNNFDCGIFIAEFA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ulp1NP_573362.1 Ehrlichia_rpt 200..>580 CDD:118064
Peptidase_C48 1331..1506 CDD:280975 42/184 (23%)
ulp-4NP_495703.2 Peptidase_C48 145..333 CDD:304959 42/184 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5160
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.