DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HSD11B2 and CG8888

DIOPT Version :9

Sequence 1:NP_000187.3 Gene:HSD11B2 / 3291 HGNCID:5209 Length:405 Species:Homo sapiens
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:371 Identity:105/371 - (28%)
Similarity:157/371 - (42%) Gaps:62/371 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    29 RLGRPLL----AALA---LLAALDWLCQRLLPPPAALAVLAAAGWIALSRLARP-----QRLPVA 81
            ||..|.|    ||:.   ||.|||         .::::..|...|.||:.:...     .::..:
  Fly    39 RLFMPFLFCQAAAIVTSHLLHALD---------ISSISTFAVFVWFALATVGAVLFYHFVKVSAS 94

Human    82 TRAVLITGCDSGFGKETAKKLDSMGFTVLA---TVLELNSPGAIELRTCCSPRLRLLQMDLTKPG 143
            .:.||||||::......|||||.:||||.|   |.:|.:....| |:...|.|::||.:|:|...
  Fly    95 GKGVLITGCEAPLAWYLAKKLDDLGFTVYAGFNTPIEESDEAKI-LKEVTSGRMKLLHLDVTSEK 158

Human   144 DISRVLEFTKAHTT--STGLWGLVNNAGHNEVVADAELSPVATFRSCMEVNFFGALELTKGLLPL 206
            .|.....:...|..  :.|||.:|:.| |...:.:.|..|.|..|..:::|..|:..||:..|||
  Fly   159 TILEAARYVSQHLPHGAEGLWSVVHCA-HWIALGELEWIPFAVLRKSLDLNLLGSARLTQIFLPL 222

Human   207 LRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVALLMDTFSCELLPWGVKVSIIQPGCF------ 265
            :|.:.||:|.:.|....:|.|..|....::|||.........|:...||.||::..|.|      
  Fly   223 VRRAHGRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEMRTRGVDVSVVAAGEFAPGNGW 287

Human   266 --KTESVRNVGQ-WEKRKQLLLANLPQELLQAYGKDYIEHLHGQFLHSLRLAMSDLTPVVDAITD 327
              :||......| |.:        |..|..:.||:||.|..........|.| :|:.|.:..:.|
  Fly   288 LNETELRDQAKQMWNQ--------LSSEQKKTYGEDYYEAAMTSVEKYSRQA-ADIQPTLRVLID 343

Human   328 ALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRRRFLQAFFISHCLP 373
            |:....|..||.|             :....|   ||.|...|..|
  Fly   344 AVTRTFPMARYTP-------------VTSSER---LQIFLAEHLAP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HSD11B2NP_000187.3 type2_17beta_HSD-like_SDR_c 83..363 CDD:187665 85/293 (29%)
Essential for protein stability 335..339 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 377..405
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 90/305 (30%)
adh_short 96..293 CDD:278532 64/198 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1610
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D370032at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1882
SonicParanoid 1 1.000 - - X110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.