DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and pgap2

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_005161358.1 Gene:pgap2 / 541417 ZFINID:ZDB-GENE-050320-119 Length:254 Species:Danio rerio


Alignment Length:236 Identity:88/236 - (37%)
Similarity:131/236 - (55%) Gaps:6/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FHELCVVTALLPLVTLFTCFVTAYVFQYDDVHETHCRVYNIIPSISAITGVSPQRYFWRFSIALH 139
            |..|.|:|..|||:.|..|.|.|.::.|:|...|||:|.|.:|||||...::|:||.|||||.||
Zfish    20 FTRLAVITVCLPLLGLVACIVLAMLYHYNDATYTHCQVPNYLPSISAAISLTPERYIWRFSIGLH 84

  Fly   140 IGPRIPIAFVYKNYYRSQLRRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNRENYPVHER 204
            ..||..:|..|.::||.:..|....|     ||.....:|...|...|..:||:|:.|.|.||:.
Zfish    85 SAPRFLVAAAYLSFYRGRFSRRLTEQ-----LLSGFTFLLALSENVGLLLLTYVSSTETYSVHKS 144

  Fly   205 IFITFMVCSLCYMLATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYC 269
            .||.|:..||.:||.|.||..:: ...::|.::::|..:|..||..:....|..:.|:.:|..||
Zfish   145 GFILFIGSSLFHMLCTCKLWSLI-VKYSISSEEMMSYWFKLRLFLFNGGCCVLAVYFYRRHNTYC 208

  Fly   270 HDLAFSWFAFFEYLIAIANMLFHFTIIWDFPSQFMMIVQGP 310
            .:..::.||..|||:.::||.||.|..|||..:.:|:...|
Zfish   209 EEGIYTCFAVCEYLVVLSNMAFHMTAYWDFGGKEVMVATPP 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 85/224 (38%)
pgap2XP_005161358.1 Frag1 19..241 CDD:287278 86/226 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581262
Domainoid 1 1.000 126 1.000 Domainoid score I5356
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.