DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and ZK185.4

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_001033462.1 Gene:ZK185.4 / 3896817 WormBaseID:WBGene00044480 Length:281 Species:Caenorhabditis elegans


Alignment Length:253 Identity:58/253 - (22%)
Similarity:102/253 - (40%) Gaps:36/253 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PLVTLFTCFVTAYVFQYDDV--HETHC-RVYNIIPSISAITGVSPQRYFWRFSIALHIGPR-IPI 146
            ||.......:||.:...|.:  :...| |.:  :||:|.|..::.:...|:..|..||..| :.:
 Worm    36 PLFAAVFAILTAIILHQDKITNYAWICGRAF--LPSLSRIINLTLEGLVWQLCIFFHIPFRLLEL 98

  Fly   147 AFVYKNYYRSQLRRISPAQVPQTSLL-----ITLILVLNCIEIASLGGVTYISNRENYPVHERIF 206
            :..:..|.|.:.|       ..|..|     ..|.||....|:..|.|::.|..:|:...|...|
 Worm    99 SVGWVRYGRLESR-------ANTHRLWYKMHRHLYLVFGVTELILLSGLSAIGEKEHGIWHVCFF 156

  Fly   207 ITFMVCSLCYMLATIKLNGILNAGQA--LSEKQLLSIKWKKILFAVSILSTVGLLVFFAKHRFYC 269
            .:|.|.:|.:.::    |.:.::...  |:....:|...|.::.....||...:..|:|.:...|
 Worm   157 YSFGVVALLFFIS----NTVCHSQSLYFLNPYGRISYHVKIVISICYFLSAPAIATFYALYWKAC 217

  Fly   270 HDLAFSWFAFFEYLIAIANMLFH-FTIIWDFPSQFMMIVQGPRENLAQYLSNRP-KLD 325
            ...|:..||..|||.....:.:| ..:.||...:.:..|:          .|:| |||
 Worm   218 FTWAYELFALVEYLDVFMVIFYHGCCVYWDIQHKVVFSVR----------LNKPSKLD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 52/225 (23%)
ZK185.4NP_001033462.1 Frag1 26..251 CDD:287278 52/227 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159525
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.