DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and PGAP2

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_608548.1 Gene:PGAP2 / 33258 FlyBaseID:FBgn0031284 Length:255 Species:Drosophila melanogaster


Alignment Length:227 Identity:76/227 - (33%)
Similarity:122/227 - (53%) Gaps:11/227 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 FHELCVVTALLPLVTLFTCFVTAYVFQYDDVHETHCRVYNIIPSISAITG-VSPQRYFWRFSIAL 138
            |..|.:|...|||...|.|.:.:..|.:.....|||.|.|.:||:||..| ..||:..||.:|.|
  Fly    20 FARLALVALSLPLGGFFFCVIWSLTFDFVRSTYTHCDVTNYLPSVSAAIGNYEPQKTVWRLAIFL 84

  Fly   139 HIGPRIPIAFVYKNYYRSQLRRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNRENYPVHE 203
            |:..|:.:|.:|..:||..:||       ...||..|...||.:|..:|..:::.::.::|..|.
  Fly    85 HLPLRLAVAKIYLEHYREHIRR-------SRRLLGILACFLNVVEDLALFCLSFWTSADHYETHR 142

  Fly   204 RIFITFMVCSLCYMLATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLVF-FAKHRF 267
            ..|:.|:.||.||||.:..||..:.....|..:: .|:::|:.||.|:::: .||..: |.:|..
  Fly   143 NAFVVFIACSECYMLVSYLLNRNIQKTVLLPHEE-KSLRYKRNLFLVNVIA-FGLAGYCFVRHNS 205

  Fly   268 YCHDLAFSWFAFFEYLIAIANMLFHFTIIWDF 299
            :|....:::||.|||::.:.||.||.|..|||
  Fly   206 HCEAGVYTFFALFEYIVVLTNMGFHMTSYWDF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 76/227 (33%)
PGAP2NP_608548.1 Frag1 19..240 CDD:287278 76/227 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449508
Domainoid 1 1.000 126 1.000 Domainoid score I5356
eggNOG 1 0.900 - - E1_KOG3979
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12892
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R277
SonicParanoid 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.