DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and Y38F1A.8

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_496766.1 Gene:Y38F1A.8 / 189674 WormBaseID:WBGene00012610 Length:303 Species:Caenorhabditis elegans


Alignment Length:283 Identity:62/283 - (21%)
Similarity:118/283 - (41%) Gaps:32/283 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TISSKQADA---REPQEQQV--AIHYLASFHELCVVTALLPLVTLFTCFVTAYVFQYDDVHE-TH 109
            ||:|....|   :||.:..:  .:..:.....:..:.||||....:......|:||::.|.. |.
 Worm    14 TIASMAEKAKLKKEPMKSPIEDTVEKMLRIRWVVCLGALLPGAGCYFVVAYTYLFQFEKVSNFTE 78

  Fly   110 CRV---YNI-IPSISAITGV-SPQRYFWRFSIALHIGPRIPIAFVYKNYYR-SQLRRISPAQVPQ 168
            |:.   .|| :|.:|...|: .||:|.|...:.:|:.||:....:|:..:. |..:.:..|:|..
 Worm    79 CKECPNMNITLPPVSYSIGIWQPQKYIWMMIMFIHVPPRLFFLMLYRRLFLISAPKSVWYARVNY 143

  Fly   169 TSLLI----TLILVLNCIEIASLGGVTYISNRENYPVHERIFITFMVCSLCYMLATIKLNGILNA 229
            ..:|.    .|.|||  :.:..:.|        .:.:|...|..:::|....||..|.|:   :.
 Worm   144 VYMLTLWAEPLGLVL--VSVVDING--------GFILHALGFAIWIICFNFNMLFNIILH---HF 195

  Fly   230 GQALSEKQLLSIKW--KKILFAVSILSTVGLLVFFAKHRFYCHDLAFSWFAFFEYLIAIANMLFH 292
            |........:...|  |.::|.|.....:...:.:.....:|...|::.|:..|.:....|.||:
 Worm   196 GGCRDVHDTMETTWRIKCVIFLVGYFCAISTPITYPYFTAHCSPYAYNLFSLAELIEVGCNSLFY 260

  Fly   293 FTIIWDFPSQFMMI-VQGPRENL 314
            ....::||...:.| ::..:.||
 Worm   261 SIAYFEFPKTRITIGIKSVQRNL 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 51/238 (21%)
Y38F1A.8NP_496766.1 Frag1 45..269 CDD:287278 52/236 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3979
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.