DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and F36H9.5

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:NP_503503.1 Gene:F36H9.5 / 185391 WormBaseID:WBGene00018113 Length:352 Species:Caenorhabditis elegans


Alignment Length:175 Identity:40/175 - (22%)
Similarity:69/175 - (39%) Gaps:16/175 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 WRFSIALHIGPRIPIAFVYKNYYRSQLRRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNR 196
            :|.:..|.|..|...:.|::|...:...|..|.  |....|..|:.:|..||..:|...:.|:..
 Worm   137 FRLATCLTIAVRFFQSIVFRNLLINGFWREVPN--PMFRWLCDLLPMLTLIETTALAMFSIITMH 199

  Fly   197 ENY-PVHERIFITFMVCSLCYMLATIKLNGILNAGQALSEKQLLSIKWKKILFAVSILSTVGLLV 260
            .:: .::.....||.:.|:..|......:.:|:...  |:|...||.:.:.:.||    ..|...
 Worm   200 SDFKEINHFCKSTFAIVSVVNMCIPTIFHFVLSINS--SKKAEASIVFVRAVCAV----VFGYCA 258

  Fly   261 --FFAKH-----RFYCHDLAFSWFAFFEYLIAIANMLFHFTIIWD 298
              :|..|     ...||......||..||.:.:|.:.||...:.|
 Worm   259 PQYFQFHIGWTKESLCHSYIPRHFAIMEYSLFLAYITFHLLSLLD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 40/175 (23%)
F36H9.5NP_503503.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159527
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.