DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7990 and Pgap2

DIOPT Version :9

Sequence 1:NP_573361.1 Gene:CG7990 / 32909 FlyBaseID:FBgn0030997 Length:325 Species:Drosophila melanogaster
Sequence 2:XP_006229887.1 Gene:Pgap2 / 116675 RGDID:619744 Length:339 Species:Rattus norvegicus


Alignment Length:142 Identity:61/142 - (42%)
Similarity:78/142 - (54%) Gaps:8/142 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 VVTALLPLVTLFTCFVTAYVFQYDDVHETHCRVYNIIPSI-SAITGVSPQRYFWRFSIALHIGPR 143
            |:|  .||...|.|.:.:.||.::....|.|.|.|.:||: |||.|..||||.|||.|.||..||
  Rat    99 VIT--FPLFGFFFCIIWSLVFHFEYTVATDCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPR 161

  Fly   144 IPIAFVYKNYYRSQLRRISPAQVPQTSLLITLILVLNCIEIASLGGVTYISNRENYPVHERIFIT 208
            ...||.|.|:|   |...||.  |...||..|...||.:|..:|..:||:|:.|::.:||..||.
  Rat   162 FLTAFAYWNHY---LSCASPC--PGYRLLCRLNFSLNVVENLALLVLTYVSSSEDFTIHENAFIV 221

  Fly   209 FMVCSLCYMLAT 220
            |:..||.|||.|
  Rat   222 FIAASLSYMLLT 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7990NP_573361.1 Frag1 74..300 CDD:287278 61/142 (43%)
Pgap2XP_006229887.1 Frag1 102..>253 CDD:402067 59/137 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003719
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12892
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.