DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14194 and AT1G73950

DIOPT Version :9

Sequence 1:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_177535.2 Gene:AT1G73950 / 843732 AraportID:AT1G73950 Length:466 Species:Arabidopsis thaliana


Alignment Length:310 Identity:77/310 - (24%)
Similarity:119/310 - (38%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 IVHCSLFIFVTLFALRLDNYIDWPYWAIFTPLWIWKCTAILGAI-VGAIVWCRYPHYRLEGDAYT 79
            :.||.||.|.....|:||:.|.:.:|.:..|||.:......|.. :.|.:..|..|:        
plant    14 VAHCFLFSFTLALVLKLDHSITYSWWVVCLPLWAFHAVVARGRFSLPAPIAPRNRHW-------- 70

  Fly    80 QFKAMLISLALHLILLMFELLAC---DKLTSDRHLWV---LVFIPLIFGSVV------------- 125
               |...::....:|:.||||.|   :...:|....|   :||:||:...|:             
plant    71 ---APCHAIVSTPLLIAFELLLCVYLETAYADSPPAVSLKIVFLPLLAFEVIILVDNARMCRALM 132

  Fly   126 -----SVG-ACVW-AVKHD-RSFELELFLAVNALQFVSLPLKLDRFVYWNWDVVFVPMWIVICLS 182
                 ||. ..|| |:.|. .:..:..|||  |..|..|.|..|......|| :|:...|..|.:
plant   133 PGDEESVNDEAVWEALPHFWVAISMVFFLA--ATVFTLLKLSGDVAALGWWD-LFINFGIAECFA 194

  Fly   183 LV--------------------SVLYNIIF------CGIMMRTPEVSLQQKKAALNAAVGNICTV 221
            .:                    |...||.:      .|:.   .|....|....|....|:|..:
plant   195 FLVCTKWSNPVIHRSSRDRETGSSSTNIRYLDWNSGLGVF---SEDDRNQDTCGLQDIGGHIMKI 256

  Fly   222 LPLLCFQVVICDKLDG------ELKFPYIVVFSPLLVSILALIVLSSSAK 265
             ||:.||||:|..|:|      .:..|  |:||||.: :..:.||.:::|
plant   257 -PLIVFQVVLCMHLEGTPEAAKSISVP--VLFSPLFL-LQGVGVLFAASK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:287271 69/282 (24%)
AT1G73950NP_177535.2 Tmemb_185A 28..291 CDD:287271 69/283 (24%)
zf-C3HC4_3 415..460 CDD:290631
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D554512at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.