Sequence 1: | NP_573360.1 | Gene: | CG14194 / 32908 | FlyBaseID: | FBgn0030996 | Length: | 358 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_189219.1 | Gene: | HMT-1 / 822186 | AraportID: | AT3G25900 | Length: | 326 | Species: | Arabidopsis thaliana |
Alignment Length: | 207 | Identity: | 39/207 - (18%) |
---|---|---|---|
Similarity: | 60/207 - (28%) | Gaps: | 79/207 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 54 AILGAIVGAIVWCRYPHYRLEGDAYTQFKAMLISLALHLILLMFELLACDKLTSDRHLWVLVFIP 118
Fly 119 LIFGSVVSVGACVWAVKHDRSFELELFLAVNALQFVSLPLKLDR---FVYWNWDVVFVPMWIVI- 179
Fly 180 ---------------CLSLVSVLYNIIFCGIMMRTPEV--SLQQKKAALNAAV------------ 215
Fly 216 GNICTVLPLLCF 227 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG14194 | NP_573360.1 | Tmemb_185A | 30..253 | CDD:287271 | 39/207 (19%) |
HMT-1 | NP_189219.1 | PLN02489 | 1..326 | CDD:215269 | 39/207 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |