DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14194 and HMT-1

DIOPT Version :9

Sequence 1:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_189219.1 Gene:HMT-1 / 822186 AraportID:AT3G25900 Length:326 Species:Arabidopsis thaliana


Alignment Length:207 Identity:39/207 - (18%)
Similarity:60/207 - (28%) Gaps:79/207 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 AILGAIVGAIVWCRYPHYRLEGDAYTQFKAMLISLALHLILLMFELLACDKLTSDRHLWVLVFIP 118
            |::.|.:|:     |..|..:|..|:......:||              |||..           
plant   125 ALVAASIGS-----YGAYLADGSEYSGHYGENVSL--------------DKLKD----------- 159

  Fly   119 LIFGSVVSVGACVWAVKHDRSFELELFLAVNALQFVSLPLKLDR---FVYWNWDVVFVPMWIVI- 179
                            .|.|..::.:....:.|.|.::|.||:.   ......:.|.:|.||.. 
plant   160 ----------------FHRRRLQVLVEAGPDLLAFETIPNKLEAQACVELLEEEKVQIPAWICFT 208

  Fly   180 ---------------CLSLVSVLYNIIFCGIMMRTPEV--SLQQKKAALNAAV------------ 215
                           ||..::...||...||....|:.  :|.:|.|.|....            
plant   209 SVDGEKAPSGESFEECLEPLNKSNNIYAVGINCAPPQFIENLIRKFAKLTKKAIVVYPNSGEVWD 273

  Fly   216 GNICTVLPLLCF 227
            |.....||..||
plant   274 GKAKQWLPSQCF 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:287271 39/207 (19%)
HMT-1NP_189219.1 PLN02489 1..326 CDD:215269 39/207 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.