DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14194 and CG13919

DIOPT Version :9

Sequence 1:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_647637.1 Gene:CG13919 / 38200 FlyBaseID:FBgn0035248 Length:131 Species:Drosophila melanogaster


Alignment Length:120 Identity:31/120 - (25%)
Similarity:51/120 - (42%) Gaps:11/120 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 VSLPLKLDRFVYWNWDVVFVPMWIVICLSLVSVLYNII--FCGIMMRTPEVSLQQKKAALNAAVG 216
            :.|.|:||....|||.|.|.|:|....:.::.|:...|  :..:...|..:.|.:         .
  Fly    19 ILLCLRLDPRTTWNWFVTFTPLWFFDVIIIIYVIIKFIRKWRNLTCLTDLLFLYK---------W 74

  Fly   217 NICTVLPLLCFQVVICDKLDGELKFPYIVVFSPLLVSILALIVLSSSAKGGNMWW 271
            ||..||..:..||:||..|:...:.|..|..:|:::.:...|....|..|....|
  Fly    75 NIAGVLLTIASQVMICLTLEYPQQIPIYVTVAPVILLLSTAIFYVGSRLGKREGW 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:287271 27/100 (27%)
CG13919NP_647637.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3879
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13568
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.