DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14194 and Tmem60

DIOPT Version :9

Sequence 1:NP_573360.1 Gene:CG14194 / 32908 FlyBaseID:FBgn0030996 Length:358 Species:Drosophila melanogaster
Sequence 2:NP_808269.1 Gene:Tmem60 / 212090 MGIID:2673965 Length:133 Species:Mus musculus


Alignment Length:170 Identity:33/170 - (19%)
Similarity:60/170 - (35%) Gaps:57/170 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 IFVTLFALRLDNYIDWPYWAIFTPLWIWKCTAILGAIVGAIVWCRYPHYRLEGDAYTQFKAMLIS 87
            :|:.:..|:||....|.::.||.|:||:....::..||.....|:.......|....:.||.   
Mouse    18 LFLIMLVLKLDEKAPWNWFLIFIPVWIFDTILLVMLIVKMAGRCKSGFDPRHGSHNIKKKAW--- 79

  Fly    88 LALHLILLMFELLACDKLTSDRHLWVLVFIPLIFGSVVSVGACVWAVKHDRSFELELFLAVNALQ 152
               :||.::.:|..|                                                  
Mouse    80 ---YLIAMLLKLAFC-------------------------------------------------- 91

  Fly   153 FVSLPLKLDRFVYWNWDVVFVPMWIVICLSLVSVLYNIIF 192
             ::|..||::|...|...||:|:|.::..:|..:.||:.|
Mouse    92 -LALCAKLEQFTTMNLSYVFIPLWALLAGALTELGYNVFF 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14194NP_573360.1 Tmemb_185A 30..253 CDD:287271 32/163 (20%)
Tmem60NP_808269.1 Tmemb_185A 25..>118 CDD:402059 28/149 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3879
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.