DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7914 and Cyb5r4

DIOPT Version :10

Sequence 1:NP_573359.1 Gene:CG7914 / 32907 FlyBaseID:FBgn0030995 Length:315 Species:Drosophila melanogaster
Sequence 2:NP_077157.2 Gene:Cyb5r4 / 266690 MGIID:2386848 Length:528 Species:Mus musculus


Alignment Length:167 Identity:36/167 - (21%)
Similarity:75/167 - (44%) Gaps:28/167 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 KRNVILSYTKFRLLRREALGPNGQLLLLHFAHAAEEGDGDGAVDTVLDIPPGHHVMLRV----GS 105
            |::..|.|.:.:|:.:|.:..:.:|..|....:           |.|.:|.|.||.|::    ..
Mouse   275 KKDTGLYYRRCQLISKEDVTHDTRLFCLMLPPS-----------THLQVPVGQHVYLKLSVTGAE 328

  Fly   106 LLRPYSPYWSDFVAKEFR-----------ILVKLQPEGPMSRHLQAVQPDDLLEFRGPIGQY-VH 158
            :::||:|. ||.:..:|:           .|:|:.|.|..:..|..:|..|.:...||.|.: |.
Mouse   329 IVKPYTPV-SDSLLSDFKEPVLSPNKYICFLIKIYPAGLFTPELDRLQIGDFISVSGPEGDFKVS 392

  Fly   159 EPQPAKCIYIIAQGVAIAPTLPLVRQVLDNEEDMSRL 195
            :.|..:.::::|.|....|.:.::...|.:...:.::
Mouse   393 KLQEVEDLFLLAAGTGFTPMVTVLNYALSHMSSLRKV 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7914NP_573359.1 cyt_b5_reduct_like 55..315 CDD:99780 33/157 (21%)
Cyb5r4NP_077157.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
Cyt-b5 58..130 CDD:459698
p23_NCB5OR 177..263 CDD:107240
cyt_b5_reduct_like 285..526 CDD:99780 33/157 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.