DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1D3csd and cbx3b

DIOPT Version :10

Sequence 1:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001373276.1 Gene:cbx3b / 567497 ZFINID:ZDB-GENE-070628-2 Length:194 Species:Danio rerio


Alignment Length:58 Identity:13/58 - (22%)
Similarity:28/58 - (48%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 DALLVRGKAIENVMYSYMLGDTVYFIVTWKGSKWGEAVPVQEIKHVHPKLLIDYIKSL 175
            :..:|:..|:|.::...:....|.:.:.|||....|.....|.....|:|:.:|:::|
Zfish    14 ETTVVQEFAVEKIIRRRVNNGKVEYYLKWKGFTDAENTWEPEDNLDCPELIEEYLRNL 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1D3csdNP_573358.1 None
cbx3bNP_001373276.1 CD_CSD 20..68 CDD:475127 10/47 (21%)
Chromo_shadow 137..188 CDD:460191
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.