DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1D3csd and HP1c

DIOPT Version :10

Sequence 1:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_651093.1 Gene:HP1c / 42696 FlyBaseID:FBgn0039019 Length:237 Species:Drosophila melanogaster


Alignment Length:53 Identity:12/53 - (22%)
Similarity:27/53 - (50%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 RGKAIENVMYSYMLGDTVYFIVTWKGSKWGEAVPVQEIKHVHPKLLIDYIKSL 175
            ||..:..::.:..:...:.::|.|:.....:.||..:|....|::||||.:.:
  Fly    83 RGLELAEIVGATDVTGDIKYLVRWQFCDEFDLVPSAQIVEKDPQMLIDYFQKM 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1D3csdNP_573358.1 None
HP1cNP_651093.1 CD_CSD 8..55 CDD:475127
CSD 85..135 CDD:349275 10/49 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.