DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1D3csd and HP1b

DIOPT Version :10

Sequence 1:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_572521.2 Gene:HP1b / 31834 FlyBaseID:FBgn0030082 Length:240 Species:Drosophila melanogaster


Alignment Length:184 Identity:37/184 - (20%)
Similarity:61/184 - (33%) Gaps:74/184 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KENSPNNKNTGGFPAEEEKQKENDQQKENDQQKENDQQEEVQEEPTK--------DESKEAGSTP 60
            :|:..|||.      |.:|:.......|:.:.|.....|:..||..|        :.||..|:|.
  Fly    51 EESLKNNKK------ETKKRLSTSSTPESIRSKRKSFLEDDTEEQKKLIGFERGLEASKILGATD 109

  Fly    61 PPKH----MGVHNSARAEL--ARL----LVELLVQ--------------------QAELDATNG- 94
            ...|    |....|..|:|  |:|    ..::::|                    ...|.::.| 
  Fly   110 SSGHLMFLMKWKGSDHADLVPAKLANTRCPQVVIQFYEERLTWHTGSGNGNGNTNSVNLGSSGGL 174

  Fly    95 GSVSG-------------------NLDGGNSNESQPL----------NVPPTDA 119
            |||.|                   |:|||:..:.:|.          |:.|.::
  Fly   175 GSVGGSGAGDDTAPGSVGTTGGGSNIDGGDEEDPEPASPIGSINQDENIKPDES 228

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
HP1D3csdNP_573358.1 None