DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1D3csd and CBX5

DIOPT Version :10

Sequence 1:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_036249.1 Gene:CBX5 / 23468 HGNCID:1555 Length:191 Species:Homo sapiens


Alignment Length:67 Identity:13/67 - (19%)
Similarity:32/67 - (47%) Gaps:12/67 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 FPAEEEKQKENDQQK-----ENDQQKEN--DQQEEVQEEPTKDESKEAG-----STPPPKHMGVH 68
            |..:.:|.||.:..|     |::::|.|  :..::::.:..:::|.:..     ...|.|.:|..
Human    66 FMKKYKKMKEGENNKPREKSESNKRKSNFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGAT 130

  Fly    69 NS 70
            :|
Human   131 DS 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1D3csdNP_573358.1 None
CBX5NP_036249.1 CD_HP1alpha_Cbx5 19..68 CDD:349298 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..117 8/46 (17%)
CSD_HP1alpha_Cbx5 116..173 CDD:349302 4/17 (24%)

Return to query results.
Submit another query.