DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HP1D3csd and LOC1269242

DIOPT Version :10

Sequence 1:NP_573358.1 Gene:HP1D3csd / 32906 FlyBaseID:FBgn0030994 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_307857.3 Gene:LOC1269242 / 1269242 VectorBaseID:AGAMI1_013677 Length:213 Species:Anopheles gambiae


Alignment Length:168 Identity:31/168 - (18%)
Similarity:52/168 - (30%) Gaps:58/168 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KENSPNNKNTGGFPAEEEKQKENDQQKENDQQKENDQQEEVQEEPTKDESKEAGSTPPPKHMGVH 68
            |..:...|.|||       :.|||    ||...:..:.:....:..|.:|.:.|..|        
Mosquito    88 KRTTTKKKRTGG-------ESEND----NDGSDDEGRDDNASTKSNKSKSNDDGGDP-------- 133

  Fly    69 NSARAELARLLVELLVQQAELDATNGGSVSGNLDGGNSNESQPLNVPPTDALLVRGKAIENVMYS 133
            ..|..|...          ||:....|.|...:.|....:::.|                     
Mosquito   134 KQADGEAVE----------ELNGFEKGYVPEKILGATEGDNELL--------------------- 167

  Fly   134 YMLGDTVYFIVTWKGSKWGEAVPVQEIKHVHPKLLIDY 171
                    |::.||.....:.|..:|.:...|:|:||:
Mosquito   168 --------FLIQWKDKDKAQLVKSKEARKHCPQLVIDF 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HP1D3csdNP_573358.1 None
LOC1269242XP_307857.3 CD_CSD 23..72 CDD:475127
Chromo_shadow 153..204 CDD:460191 11/74 (15%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.