DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and PHB2

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_011747.2 Gene:PHB2 / 853146 SGDID:S000003463 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:72/294 - (24%)
Similarity:120/294 - (40%) Gaps:60/294 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVPGTTQQY-------------RGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFI---CFKV 91
            |.||..|:|             .|.:.....|:|....:..|      ::....|:||   .|.|
Yeast     3 RSPGEFQRYAKAFQKQLSKVQQTGGRGQVPSPRGAFAGLGGL------LLLGGGALFINNALFNV 61

  Fly    92 VAEYERAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAV 155
            ...: |||:: |:..:|......|..||.|.:|.....|:|....||..... |||...|.:...
Yeast    62 DGGH-RAIVYSRIHGVSSRIFNEGTHFIFPWLDTPIIYDVRAKPRNVASLTG-TKDLQMVNITCR 124

  Fly   156 VYYRISDPLYAVIQV--------EDYSMSTRLLAA---TTLRNIVGTRNLSELLTERETLAHNMQ 209
            |   :|.|  .|:|:        :||  ..|:|.:   ..|:.:|...|.|:|:|:||.::..::
Yeast   125 V---LSRP--DVVQLPTIYRTLGQDY--DERVLPSIVNEVLKAVVAQFNASQLITQREKVSRLIR 182

  Fly   210 ATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDA--------------RAKVIAAEG 260
            ..|......:.::::.|.|..::.......|:.|:..|.:||              :..|:.|:|
Yeast   183 ENLVRRASKFNILLDDVSITYMTFSPEFTNAVEAKQIAQQDAQRAAFVVDKARQEKQGMVVRAQG 247

  Fly   261 EKKSATALKEASDVISASPSALQLRYLQTLSSIS 294
            |.|||..:.||   |..|...::|:.|.|...|:
Yeast   248 EAKSAELIGEA---IKKSRDYVELKRLDTARDIA 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 40/161 (25%)
SPFH_like 107..314 CDD:302763 54/213 (25%)
PHB2NP_011747.2 SPFH_prohibitin 58..252 CDD:259799 50/202 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.