DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and PHB1

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_011648.3 Gene:PHB1 / 853033 SGDID:S000003364 Length:287 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:71/288 - (24%)
Similarity:120/288 - (41%) Gaps:47/288 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 LIFIITS---PIAIFICFKVVAEYE-----RAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDL 130
            ||.:||.   ||.|.......:.|:     |.:|| |:..:.....|.|..|::|.:.:....|:
Yeast     7 LIDVITKVALPIGIIASGIQYSMYDVKGGSRGVIFDRINGVKQQVVGEGTHFLVPWLQKAIIYDV 71

  Fly   131 RTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDP----LYAVIQVEDYSMSTRLLAA---TTLRNI 188
            ||...::..... |||...|::...|.:|   |    |.|:.|........|:|.:   ..|::|
Yeast    72 RTKPKSIATNTG-TKDLQMVSLTLRVLHR---PEVLQLPAIYQNLGLDYDERVLPSIGNEVLKSI 132

  Fly   189 VGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDA-- 251
            |...:.:||:|:||.::..::..|......:|:.:|.|.|..::......:|:..:..|.:||  
Yeast   133 VAQFDAAELITQREIISQKIRKELSTRANEFGIKLEDVSITHMTFGPEFTKAVEQKQIAQQDAER 197

  Fly   252 ------------RAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAE-KNSTIIF 303
                        :|.||.||||.:||..:.:|  :.......|.:|.|:....|:.. .||:.:.
Yeast   198 AKFLVEKAEQERQASVIRAEGEAESAEFISKA--LAKVGDGLLLIRRLEASKDIAQTLANSSNVV 260

  Fly   304 PLPMELLTPYLAKYAHLMGPPPELKQSP 331
            .||.:          |..|...|...||
Yeast   261 YLPSQ----------HSGGGNSESSGSP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 37/162 (23%)
SPFH_like 107..314 CDD:302763 54/228 (24%)
PHB1NP_011648.3 SPFH_prohibitin 29..223 CDD:259799 48/197 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.