DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and AT5G51570

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_199970.1 Gene:AT5G51570 / 835231 AraportID:AT5G51570 Length:292 Species:Arabidopsis thaliana


Alignment Length:267 Identity:53/267 - (19%)
Similarity:98/267 - (36%) Gaps:83/267 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 IIFRLGRLSGGARGPGMFFILPCIDEY---------RKVDLRTVTFNVPQQEMLTKDSVTVTVDA 154
            ::.|.||....|. ||..|..|...::         :.:|::.        |..|||:|.|.:..
plant    19 VVERWGRFEHIAE-PGCHFFNPLAGQWLAGVLSTRIKSLDVKI--------ETKTKDNVFVQLVC 74

  Fly   155 VVYYRI-----SDPLYAV----IQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQA 210
            .:.||:     .|..|.:    .|::.|...       .:|.:|....|..|..::..:|.::..
plant    75 SIQYRVVKASADDAFYELQNPKEQIQAYVFD-------VVRALVPMMTLDALFEQKGEVAKSVLE 132

  Fly   211 TLDEATEPWGVMVERVEIKDVSLPVSMQRAM---------------AAEAE-------AARDARA 253
            .|::....:|..:|.:.:.|:....|:::||               ..|||       |..:|.|
plant   133 ELEKVMGAYGYSIEHILMVDIIPDPSVRKAMNEINAAQRLQLASVYKGEAEKILQVKRAEAEAEA 197

  Fly   254 KVIAAEG--------------------EKKSATALKEASDVISASPSALQLRYLQTLSSI-SAEK 297
            |.:...|                    :|...|:.||..|:|..:      :|..|:..: ::.|
plant   198 KYLGGVGVARQRQAITDGLRENILNFSDKVEGTSAKEVMDLIMIT------QYFDTIRDLGNSSK 256

  Fly   298 NSTIIFP 304
            |:|:..|
plant   257 NTTVFLP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 31/156 (20%)
SPFH_like 107..314 CDD:302763 50/259 (19%)
AT5G51570NP_199970.1 SPFH_like_u4 11..280 CDD:259805 53/267 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.