DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and AT4G27585

DIOPT Version :10

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_567778.1 Gene:AT4G27585 / 828868 AraportID:AT4G27585 Length:411 Species:Arabidopsis thaliana


Alignment Length:54 Identity:14/54 - (25%)
Similarity:17/54 - (31%) Gaps:13/54 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KTEKKPEKKSEENTCFTK-------ED-----CGDIWDCCNILCC-FCSIFRSY 73
            :..|......|:|.|..|       ||     ...|...|:|.|. ...||..|
plant   265 RCSKDEMSNKEKNGCIPKNINFLSYEDMLGATLSFISVICSIACAVILGIFIKY 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 SPFH_like 107..314 CDD:473137
AT4G27585NP_567778.1 HflC 62..337 CDD:440099 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.