DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and NPHS2

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_055440.1 Gene:NPHS2 / 7827 HGNCID:13394 Length:383 Species:Homo sapiens


Alignment Length:352 Identity:139/352 - (39%)
Similarity:204/352 - (57%) Gaps:36/352 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RNSGPASSTAYMVNMGAAGMAPEPALRVPGTT----QQYRGFKTSENE---------PK------ 62
            :.:||..|     ..|.||...||  |.|..|    .:.||......|         |:      
Human    39 QEAGPEPS-----GSGRAGTPGEP--RAPAATVVDVDEVRGSGEEGTEVVALLESERPEEGTKSS 96

  Fly    63 --GCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGR-LSGGARGPGMFFILPCIDE 124
              |..||::.|.|:|..|:|.|.:|:.|.|||.||||.||||||. |.|.|:|||:||.|||:|.
Human    97 GLGACEWLLVLISLLFIIMTFPFSIWFCVKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDT 161

  Fly   125 YRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIV 189
            |.|||||..|..:|..|::|||...:.:||:.|||:.:....:..:...|.:.:.|..||::.::
Human   162 YHKVDLRLQTLEIPFHEIVTKDMFIMEIDAICYYRMENASLLLSSLAHVSKAVQFLVQTTMKRLL 226

  Fly   190 GTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAK 254
            ..|:|:|:|.||:::|.:.:..||..|..||:.|||:|||||.||..:|.::|.||||.|.|:.:
Human   227 AHRSLTEILLERKSIAQDAKVALDSVTCIWGIKVERIEIKDVRLPAGLQHSLAVEAEAQRQAKVR 291

  Fly   255 VIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELL----TPYLA 315
            :||||.||.::.:|:.|::::|.:|:|:|||||.||.|:|.||.||::.|||.:||    :|...
Human   292 MIAAEAEKAASESLRMAAEILSGTPAAVQLRYLHTLQSLSTEKPSTVVLPLPFDLLNCLSSPSNR 356

  Fly   316 KYAHLMGPPPEL---KQSPEKSDNIVL 339
            ....|..|.|..   ..:|:|.|:.:|
Human   357 TQGSLPFPSPSKPVEPLNPKKKDSPML 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 69/150 (46%)
SPFH_like 107..314 CDD:302763 92/210 (44%)
NPHS2NP_055440.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..76 13/43 (30%)
SPFH_podocin 122..344 CDD:259809 103/221 (47%)
PHB 123..287 CDD:214581 75/163 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 355..383 6/27 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160374
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.