DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and stoml1

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001103502.1 Gene:stoml1 / 563294 ZFINID:ZDB-GENE-070209-241 Length:410 Species:Danio rerio


Alignment Length:229 Identity:79/229 - (34%)
Similarity:127/229 - (55%) Gaps:21/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GPASSTAYM-VNMGAAGMAPEPAL---RVP--GTTQQYRGF------KTSENE----PKGCMEW- 67
            |.:|...|. ::.|.:|....|.|   ..|  .:...:||.      |..:|:    .:|.:.| 
Zfish     5 GKSSGYEYQCLSQGESGYGETPGLFSSHSPFNNSHHDHRGHSFDYVPKVHQNDYTDKSQGLLSWL 69

  Fly    68 ---VVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRLSGGARGPGMFFILPCIDEYRKVD 129
               :||....|...:|.||:.:...|||..|||.::|||||:. ..:|||:..|||.||::::||
Zfish    70 CNLIVTFLVFLFTFVTFPISGWFVLKVVPNYERVVVFRLGRIR-PPKGPGVVLILPFIDQWQRVD 133

  Fly   130 LRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNL 194
            |||..||:|..::.||||..|:|.|.:.:||..|:.:|:.|:|.:.||||.|...:...:..::|
Zfish   134 LRTRAFNIPPCKVCTKDSGLVSVGADIQFRIWSPVMSVVAVQDLNSSTRLTAQNAMMTSLSKKSL 198

  Fly   195 SELLTERETLAHNMQATLDEATEPWGVMVERVEI 228
            .|:.|:|..|..::...::|.|:|||:.|:|||:
Zfish   199 REIQTDRLKLGEHLGMDMNEMTKPWGLEVDRVEL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 59/141 (42%)
SPFH_like 107..314 CDD:302763 48/122 (39%)
stoml1NP_001103502.1 PHB 94..232 CDD:214581 58/138 (42%)
SPFH_SLP-1 109..239 CDD:259814 50/125 (40%)
SCP2 301..405 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.