DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and nphs2

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001018155.2 Gene:nphs2 / 557914 ZFINID:ZDB-GENE-051102-2 Length:391 Species:Danio rerio


Alignment Length:352 Identity:110/352 - (31%)
Similarity:178/352 - (50%) Gaps:22/352 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 EPH--QDSPVYANYEDMRNSGPASSTAYMVNMGAAGMAPEPALRVPGTTQQYRGFKTSENEPKGC 64
            |||  ::..|....|:........|::.:||:.:.      ..|:....::......:|...:|.
Zfish    47 EPHKRKEKLVTTEEEEEAKDAQIISSSTVVNVDSV------RERIKEEREELLALLETEGPGEGL 105

  Fly    65 ME---------WVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGR-LSGGARGPGMFFIL 119
            .:         .:|.:.||:|..:  ||:::.|.|:|.|:|||:.||||. |....||||:.|.|
Zfish   106 KKKYLGVCELLLIVLVLSVVILFL--PISVWFCVKIVREHERAVKFRLGHLLKKRPRGPGLMFYL 168

  Fly   120 PCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATT 184
            |.:|....||:|.....:|...::|||.|...|.||.||||.:...............:.|...:
Zfish   169 PFLDVCHIVDIRLQILKIPPHMVVTKDLVCTEVTAVCYYRIENVSVCYSSFASIPDVMQALTQVS 233

  Fly   185 LRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAAR 249
            :|.|:.....:::|.:|:.:|..:|.|||..|..||:.||:.||::::||..:|...|.||||.|
Zfish   234 VREILAHHAFNDILLDRKRIAQEIQVTLDSGTCRWGIKVEKAEIEEINLPPELQHNFAVEAEARR 298

  Fly   250 DARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELLTPYL 314
            .|:.|||||||||.:..|||.:.:.:|.||..:.||.||.|.|:.:|: ..::..:|.::||..:
Zfish   299 QAQVKVIAAEGEKAACEALKASVESVSGSPLVMHLRLLQLLHSLRSEQ-PAVVLNIPPDVLTQSI 362

  Fly   315 AKYAHLMGPPPELKQSPEKSDNIVLDA 341
             ..|.|..|..:...:...||:...|:
Zfish   363 -DLASLTRPANQSMTTCHGSDDGTKDS 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 54/150 (36%)
SPFH_like 107..314 CDD:302763 75/206 (36%)
nphs2NP_001018155.2 SPFH_like 134..356 CDD:302763 85/222 (38%)
PHB 135..299 CDD:214581 60/163 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596736
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.