DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and PHB

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001268425.1 Gene:PHB / 5245 HGNCID:8912 Length:272 Species:Homo sapiens


Alignment Length:244 Identity:62/244 - (25%)
Similarity:113/244 - (46%) Gaps:41/244 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLT--KDSVTVTVDAVVYY 158
            ||:|| |...:.....|.|..|::|.:.:....|.|:...|||   ::|  ||...|.:...:.:
Human    35 RAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVP---VITGSKDLQNVNITLRILF 96

  Fly   159 R-ISDPLYAVIQV--EDYSMSTRLLAATT---LRNIVGTRNLSELLTERETLAHNMQATLDEATE 217
            | ::..|..:...  |||  ..|:|.:.|   |:::|...:..||:|:||.::..:...|.|...
Human    97 RPVASQLPRIFTSIGEDY--DERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAA 159

  Fly   218 PWGVMVERVEI------KDVSLPVSMQRAMAAEAEAAR--------DARAKVIAAEGEKKSATAL 268
            .:|::::.|.:      |:.:..|..::....|||.||        ..:|.:|:|||:.|:|..:
Human   160 TFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELI 224

  Fly   269 KEASDVISASPSALQLRYLQTLSSI----SAEKNST-------IIFPLP 306
              |:.:.:|....::||.|:....|    |..:|.|       ::..||
Human   225 --ANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 39/155 (25%)
SPFH_like 107..314 CDD:302763 57/233 (24%)
PHBNP_001268425.1 SPFH_prohibitin 27..221 CDD:259799 50/190 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.