DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and Phb2

DIOPT Version :10

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001097372.1 Gene:Phb2 / 46038 FlyBaseID:FBgn0010551 Length:338 Species:Drosophila melanogaster


Alignment Length:86 Identity:19/86 - (22%)
Similarity:30/86 - (34%) Gaps:25/86 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DPSGTSCNYPAN------LITNQPPFLPD------------SDRITGKTEKKPEKKSEEN----- 45
            |.:|....:.||      |...:|..|.|            |||...:.::.|:...|.:     
  Fly    42 DGTGAQGQHEANGRRYCLLYVARPNELGDRTQQEYGTGSNQSDREGTRRKEYPQTPFEHSWLGAI 106

  Fly    46 TCFTKEDCGDIWDCCNILCCF 66
            |..:...||  |....:||.:
  Fly   107 TWTSAIICG--WYTSQLLCLY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 SPFH_like 107..314 CDD:473137
Phb2NP_001097372.1 SPFH_prohibitin 42..236 CDD:259799 19/86 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.