DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and phb2b

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001002681.2 Gene:phb2b / 436954 ZFINID:ZDB-GENE-040718-430 Length:303 Species:Danio rerio


Alignment Length:270 Identity:58/270 - (21%)
Similarity:114/270 - (42%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 LGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVP--QQEMLTKDSVTVTVDAV----VYYRI- 160
            :||:|.|:||.|:...|..........:|..|:.|.  |:.::......|.:|.|    :::|| 
Zfish    17 MGRISSGSRGAGIGLKLLIGAGALAYGVREATYTVEGGQRAIIFNRIGGVQLDTVLTEGLHFRIP 81

  Fly   161 ------------------------------------SDPLYAVIQV------EDYSMSTRLLAA- 182
                                                |.||.:.:.:      :||  ..|:|.: 
Zfish    82 WFQYPIIYDIRARPRKISSLTGSKDLQMVNIALRVLSRPLASNLPIMYQQLGQDY--DERVLPSI 144

  Fly   183 --TTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSL-----------P 234
              ..|:::|...|.|:|:|:|..::..::..|.|..:.:.::::.|.|.::|.           .
Zfish   145 VNEVLKSVVAKFNASQLITQRAQVSLLIRRELFERAKDFNIILDDVAITELSFSREYTAAVEAKQ 209

  Fly   235 VSMQRAMAAE---AEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSI--- 293
            |:.|.|..|:   .:|.::.:.|:|.||||.::|..|.||   ::.:|..|:||.::...:|   
Zfish   210 VAQQEAQRAQFFVEKAKQEQKQKIIQAEGEAQAAKMLGEA---VTKNPGYLKLRRIRAAQNIAKT 271

  Fly   294 -SAEKNSTII 302
             :|.:|...:
Zfish   272 VAASQNKVYL 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 37/197 (19%)
SPFH_like 107..314 CDD:302763 56/266 (21%)
phb2bNP_001002681.2 SPFH_prohibitin 49..243 CDD:259799 37/195 (19%)
PHB 49..209 CDD:214581 26/161 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.