DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and CG14736

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001287293.1 Gene:CG14736 / 41466 FlyBaseID:FBgn0037986 Length:473 Species:Drosophila melanogaster


Alignment Length:281 Identity:136/281 - (48%)
Similarity:192/281 - (68%) Gaps:10/281 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GMAPEPALRVPGTTQQYRGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAI 99
            |..|.|:          |..:|||:......|.|.......:.|||.|.::..|..:|.||.|.|
  Fly    36 GPRPPPS----------RYIQTSEDNKDSTFEKVAIGICWFLVIITFPFSMCCCLTIVPEYSRMI 90

  Fly   100 IFRLGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPL 164
            |.|||||..|.||||:.||||||||..:||:||...||..|::|||||||:||:|||||.|..|:
  Fly    91 ILRLGRLRKGLRGPGLVFILPCIDETHRVDMRTDVTNVRPQDVLTKDSVTITVNAVVYYCIYSPI 155

  Fly   165 YAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIK 229
            .::|||:|...:|:|::..|||||||::.|:.|||.|:.|:..:|..:...|..|||.||||::.
  Fly   156 DSIIQVDDAKQATQLISQVTLRNIVGSKTLNVLLTSRQQLSREIQQAVAGITYRWGVRVERVDVM 220

  Fly   230 DVSLPVSMQRAMAAEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSIS 294
            |::||.|::|::|:||||.|:||||:|.||||.|::.||||||||:|.:...||||:||.||||:
  Fly   221 DITLPTSLERSLASEAEAVREARAKIILAEGELKASKALKEASDVMSENKITLQLRHLQILSSIA 285

  Fly   295 AEKNSTIIFPLPMELLTPYLA 315
            :|:...||:|:|:|::.|:::
  Fly   286 SERRVRIIYPIPLEIMEPFMS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 80/149 (54%)
SPFH_like 107..314 CDD:302763 111/206 (54%)
CG14736NP_001287293.1 PHB 78..225 CDD:214581 77/146 (53%)
SPFH_like 100..305 CDD:302763 111/204 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473036
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
65.850

Return to query results.
Submit another query.