DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and CG14644

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_649445.3 Gene:CG14644 / 40536 FlyBaseID:FBgn0250821 Length:293 Species:Drosophila melanogaster


Alignment Length:260 Identity:124/260 - (47%)
Similarity:187/260 - (71%) Gaps:1/260 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 RGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRL-SGGARGPGM 115
            |..|||||.|..|.|..:.:.|:::.::..|.::|.|.:|::|||||:|.||||| ....||||:
  Fly    29 RNVKTSENVPPTCAEKTLFVLSMILIVLCLPWSLFCCLRVMSEYERAVILRLGRLRPKPPRGPGV 93

  Fly   116 FFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLL 180
            .|::||||:...||:||.:|::.:||:||:|.||:::|.||||.|..|..|::||.|...:|..|
  Fly    94 IFLVPCIDDLAVVDIRTRSFDLHRQEILTRDMVTISIDGVVYYSIKSPFDAMLQVYDPEEATEKL 158

  Fly   181 AATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEA 245
            |.|||||:.||..|.:||:.:|.|::.::..|..:|||||:.|||||||::.:|..::||:|.|.
  Fly   159 AMTTLRNVAGTHKLMDLLSSKEYLSNQIEGILYNSTEPWGIRVERVEIKEIFMPDQLKRALAVEQ 223

  Fly   246 EAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELL 310
            ||.|:|:|||.||:||:.:.||||||:|::..:|.||||||||||:||..:...:.:||.|::::
  Fly   224 EAMREAKAKVAAAQGERDAVTALKEAADIMETNPIALQLRYLQTLNSICNDDTRSYVFPFPVDIV 288

  Fly   311  310
              Fly   289  288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 74/150 (49%)
SPFH_like 107..314 CDD:302763 99/204 (49%)
CG14644NP_649445.3 PHB 64..223 CDD:214581 77/158 (49%)
SPFH_like 89..292 CDD:302763 99/200 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473030
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
76.750

Return to query results.
Submit another query.