DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and Stom

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001011965.1 Gene:Stom / 296655 RGDID:1305109 Length:284 Species:Rattus norvegicus


Alignment Length:297 Identity:170/297 - (57%)
Similarity:221/297 - (74%) Gaps:24/297 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DMRNSGPASSTAYMVNMGAAGMAPEPALRVPGTTQQYRGFKTSENEPKGCMEWVVTLFSVLIFII 79
            |.|.||...|.                 |||   :.:|....:|..|.|   |::...|.:..:|
  Rat     3 DKRQSGHVQSQ-----------------RVP---ESFRDNSKAELGPCG---WILVAVSFIFVLI 44

  Fly    80 TSPIAIFICFKVVAEYERAIIFRLGR-LSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEML 143
            |.||:|:||.|:|.||||.||||||| |.|||:|||:||||||.|.:.|||:||::|::|.||:|
  Rat    45 TFPISIWICIKIVKEYERVIIFRLGRILQGGAKGPGLFFILPCTDSFIKVDMRTISFDIPPQEVL 109

  Fly   144 TKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNM 208
            ||||||::||.|||||:.:...||..:.:...:|||||.|||||.:||:|||::|::||.:||:|
  Rat   110 TKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHM 174

  Fly   209 QATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAKVIAAEGEKKSATALKEASD 273
            |:|||:||:.||:.|||||||||.|||.:||||||||||||:|||||||||||..::.||||||.
  Rat   175 QSTLDDATDDWGIKVERVEIKDVKLPVQLQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASM 239

  Fly   274 VISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELL 310
            ||:.||:||||||||||::|:|||||||:||||:::|
  Rat   240 VITESPAALQLRYLQTLTTIAAEKNSTIVFPLPIDML 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 94/150 (63%)
SPFH_like 107..314 CDD:302763 135/204 (66%)
StomNP_001011965.1 PHB 53..204 CDD:214581 94/150 (63%)
SPFH_stomatin 73..274 CDD:259801 134/200 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9418
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.