powered by:
Protein Alignment Mec2 and Stoml3
DIOPT Version :9
Sequence 1: | NP_573357.1 |
Gene: | Mec2 / 32905 |
FlyBaseID: | FBgn0030993 |
Length: | 350 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001099901.1 |
Gene: | Stoml3 / 295041 |
RGDID: | 1311090 |
Length: | 107 |
Species: | Rattus norvegicus |
Alignment Length: | 53 |
Identity: | 24/53 - (45%) |
Similarity: | 38/53 - (71%) |
Gaps: | 1/53 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 63 GCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRLSGG-ARGPG 114
|...|::...|.|:.:||.|::|::|.|::.|||||::|||||:... |:|||
Rat 21 GVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQADKAKGPG 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I9418 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG54926 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_100539 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
6 | 5.780 |
|
Return to query results.
Submit another query.