DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and Stoml3

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001099901.1 Gene:Stoml3 / 295041 RGDID:1311090 Length:107 Species:Rattus norvegicus


Alignment Length:53 Identity:24/53 - (45%)
Similarity:38/53 - (71%) Gaps:1/53 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 GCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRLSGG-ARGPG 114
            |...|::...|.|:.:||.|::|::|.|::.|||||::|||||:... |:|||
  Rat    21 GVCGWILFFLSFLLMLITFPVSIWMCLKIIKEYERAVVFRLGRIQADKAKGPG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 16/28 (57%)
SPFH_like 107..314 CDD:302763 4/9 (44%)
Stoml3NP_001099901.1 SPFH_like 44..>73 CDD:302763 14/28 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.