DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and CG33253

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_001259699.1 Gene:CG33253 / 2768889 FlyBaseID:FBgn0030992 Length:414 Species:Drosophila melanogaster


Alignment Length:288 Identity:213/288 - (73%)
Similarity:250/288 - (86%) Gaps:8/288 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AAGMAPEPALRVPGTTQQYRGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYER 97
            |..:.|.|:|       .|:|.|||||:..||:|.:.|:.||||.::|.||::|||||||:||||
  Fly    44 AVHIPPPPSL-------PYQGLKTSENDDMGCVEILATVVSVLIMVLTFPISVFICFKVVSEYER 101

  Fly    98 AIIFRLGRL-SGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRIS 161
            |:|||:||| ||||||||:||:|||:|:|..||||||:|:||.||:|:|||||||||||||||||
  Fly   102 AVIFRMGRLRSGGARGPGVFFVLPCVDDYYPVDLRTVSFDVPPQEVLSKDSVTVTVDAVVYYRIS 166

  Fly   162 DPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERV 226
            |||.|||||.:||.||.|||||||||::||||||||||||||::|.||.:|||||:||||.||||
  Fly   167 DPLKAVIQVYNYSHSTSLLAATTLRNVLGTRNLSELLTERETISHTMQMSLDEATDPWGVKVERV 231

  Fly   227 EIKDVSLPVSMQRAMAAEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLS 291
            ||||||||.::||||||||||||:|||||||||||.||:.||:|||::|||||||||||||||||
  Fly   232 EIKDVSLPTALQRAMAAEAEAAREARAKVIAAEGEMKSSRALREASEIISASPSALQLRYLQTLS 296

  Fly   292 SISAEKNSTIIFPLPMELLTPYLAKYAH 319
            |||.|||||||||||||||||:|...||
  Fly   297 SISTEKNSTIIFPLPMELLTPFLNTQAH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 119/150 (79%)
SPFH_like 107..314 CDD:302763 170/206 (83%)
CG33253NP_001259699.1 PHB 92..239 CDD:214581 117/146 (80%)
SPFH_SLP-4 112..319 CDD:259813 170/206 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473023
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I2259
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 1 1.000 - - mtm9367
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - P PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X6471
109.800

Return to query results.
Submit another query.