DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and SPBC16G5.07c

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_596756.1 Gene:SPBC16G5.07c / 2539877 PomBaseID:SPBC16G5.07c Length:354 Species:Schizosaccharomyces pombe


Alignment Length:208 Identity:64/208 - (30%)
Similarity:112/208 - (53%) Gaps:4/208 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KVVAEYERAIIFRLGRLSGGARGPGMFFILPCIDEYRKV-DLRTVTFNVPQQEMLTKDSVTVTVD 153
            |.|.:....::.|:||.| ....||:.|:.|.||:...: .|:.....:|.|..:|.|:|::.:|
pombe    54 KFVPQQVAYVVERMGRFS-RILTPGVAFLAPIIDKIAYIHSLKERALEIPTQSAITLDNVSLGLD 117

  Fly   154 AVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEP 218
            .|:|.::.||..|...|||...:...||.||:|:.:|...|..:|.||::|..::...:::|.|.
pombe   118 GVLYIQVYDPYKASYGVEDADYAISQLAQTTMRSEIGRLTLDHVLRERQSLNIHITDAINKAAES 182

  Fly   219 WGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQ 283
            ||:...|.||:|:..|.|:..||..:..|.|..||:::.:||::::|..:.|.........|..|
pombe   183 WGIRCLRHEIRDIRPPESVVMAMHQQVSAERQKRAEILESEGKRQAAINVAEGDKQAEILDSEGQ 247

  Fly   284 LRYLQTLSSISAE 296
              .::|::|..||
pombe   248 --KIKTINSALAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 48/148 (32%)
SPFH_like 107..314 CDD:302763 59/191 (31%)
SPBC16G5.07cNP_596756.1 PHB 52..209 CDD:214581 50/155 (32%)
SPFH_paraslipin 89..199 CDD:259811 34/109 (31%)
Band_7_C 275..337 CDD:292817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.