DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and Phb

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_114039.1 Gene:Phb / 25344 RGDID:3322 Length:272 Species:Rattus norvegicus


Alignment Length:245 Identity:64/245 - (26%)
Similarity:114/245 - (46%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 RAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLT--KDSVTVTVDAVVYY 158
            ||:|| |...:.....|.|..|::|.:.:....|.|:...|||   ::|  ||...|.:...:.:
  Rat    35 RAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVP---VITGSKDLQNVNITLRILF 96

  Fly   159 R-ISDPL---YAVIQVEDYSMSTRLLAATT---LRNIVGTRNLSELLTERETLAHNMQATLDEAT 216
            | ::..|   |..|. |||  ..|:|.:.|   |:::|...:..||:|:||.::..:...|.|..
  Rat    97 RPVASQLPRIYTSIG-EDY--DERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERA 158

  Fly   217 EPWGVMVERVEI------KDVSLPVSMQRAMAAEAEAAR--------DARAKVIAAEGEKKSATA 267
            ..:|::::.|.:      |:.:..|..::....|||.||        ..:|.:|:|||:.|:|..
  Rat   159 ATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAEL 223

  Fly   268 LKEASDVISASPSALQLRYLQTLSSI----SAEKNST-------IIFPLP 306
            :  |:.:.:|....::||.|:....|    |..:|.|       ::..||
  Rat   224 I--ANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLP 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 41/156 (26%)
SPFH_like 107..314 CDD:302763 59/234 (25%)
PhbNP_114039.1 SPFH_prohibitin 27..221 CDD:259799 52/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.