DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and sto-3

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_509941.1 Gene:sto-3 / 191966 WormBaseID:WBGene00006065 Length:267 Species:Caenorhabditis elegans


Alignment Length:252 Identity:130/252 - (51%)
Similarity:183/252 - (72%) Gaps:1/252 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 EWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRL-SGGARGPGMFFILPCIDEYRKVD 129
            ::|..:.:....::|.|::||.|.|:|.||:|.:||||||| ....||||:..:||.||.::.||
 Worm    16 DFVALICAWAFLLLTFPVSIFFCVKIVKEYDRMVIFRLGRLWQDNPRGPGIVLVLPFIDSHKTVD 80

  Fly   130 LRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNL 194
            ||.::::||.|||||:||||:.|||.||||.|||:.::.:|.|..||||.||.::|||::|||:|
 Worm    81 LRVMSYDVPTQEMLTRDSVTIGVDAAVYYRTSDPIASLARVNDAHMSTRQLAQSSLRNVLGTRSL 145

  Fly   195 SELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAKVIAAE 259
            :||:|:|..:|..::..||.||..||:.||||||||:.||..|.|||||||||.|::.|||:.|:
 Worm   146 AELMTDRHGIAVQVKYILDSATLFWGIHVERVEIKDIRLPREMCRAMAAEAEAQRESDAKVVTAQ 210

  Fly   260 GEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELLTPYLAK 316
            ||..::.|.::|:|.::.||:||||||||||..|||..|.||:.|.|||.:...:.|
 Worm   211 GELDASMAFQKAADELAGSPTALQLRYLQTLVKISAHDNHTIVVPFPMEYIKKKIRK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 82/150 (55%)
SPFH_like 107..314 CDD:302763 111/206 (54%)
sto-3NP_509941.1 PHB 37..196 CDD:214581 88/158 (56%)
SPFH_like 62..261 CDD:302763 111/198 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167810
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.650

Return to query results.
Submit another query.