DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and sto-4

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_509944.1 Gene:sto-4 / 181350 WormBaseID:WBGene00006066 Length:281 Species:Caenorhabditis elegans


Alignment Length:253 Identity:159/253 - (62%)
Similarity:208/253 - (82%) Gaps:1/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 WVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRLS-GGARGPGMFFILPCIDEYRKVDL 130
            |::|:.|.|:.:.|.|::.|.|.|||.|||||:|||||||. |||||||:|||:|||:.::|:||
 Worm    28 WIITIISYLVVLFTLPLSAFFCLKVVQEYERAVIFRLGRLKHGGARGPGIFFIIPCIESFKKIDL 92

  Fly   131 RTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMSTRLLAATTLRNIVGTRNLS 195
            |.|:|:||.||:|:||||||:||||:|:|||:...:||.|||.:.||:|||.|||||.:|||.|:
 Worm    93 RVVSFDVPPQEILSKDSVTVSVDAVIYFRISNATVSVINVEDAARSTKLLAQTTLRNFLGTRTLA 157

  Fly   196 ELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMAAEAEAARDARAKVIAAEG 260
            |:|:.|:.::..|||.|||||:||||.|||||||||.||:.:||||||||||||.|.||:|||||
 Worm   158 EMLSSRDAISMQMQAALDEATDPWGVKVERVEIKDVRLPIQLQRAMAAEAEAARAAGAKIIAAEG 222

  Fly   261 EKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPMELLTPYLAKYA 318
            |:.::.||.:|:|||:.||.|:||||||||:|||:|||:|||||.|.||:..::...|
 Worm   223 EQLASRALADAADVIATSPCAIQLRYLQTLNSISSEKNNTIIFPFPTELIAKFIQSAA 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 99/150 (66%)
SPFH_like 107..314 CDD:302763 135/207 (65%)
sto-4NP_509944.1 PHB 48..200 CDD:214581 99/151 (66%)
SPFH_like 70..270 CDD:302763 133/199 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167805
Domainoid 1 1.000 74 1.000 Domainoid score I5952
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 1 1.100 - - O PTHR10264
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.760

Return to query results.
Submit another query.