DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and phb-1

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_490929.1 Gene:phb-1 / 171768 WormBaseID:WBGene00004014 Length:275 Species:Caenorhabditis elegans


Alignment Length:242 Identity:59/242 - (24%)
Similarity:107/242 - (44%) Gaps:45/242 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 ERAIIF-RLGRLSGGARGPGMFFILPCIDEYRKVDLR-------TVTFNVPQQEMLTKDSVTVTV 152
            :||:|| |...:.....|.|..|::|.:.:....|:|       |:|.        :||...|.:
 Worm    37 QRAVIFDRFSGVKNEVVGEGTHFLIPWVQKPIIFDIRSTPRAVTTITG--------SKDLQNVNI 93

  Fly   153 DAVVYYRISDP----LYAVIQVEDYSMSTRLLAATT---LRNIVGTRNLSELLTERETLAHNMQA 210
            ...:.:|.|..    :|..|.: ||  :.|:|.:.|   |:.:|...:..|::|:||.::.....
 Worm    94 TLRILHRPSPDRLPNIYLNIGL-DY--AERVLPSITNEVLKAVVAQFDAHEMITQREVVSQRASV 155

  Fly   211 TLDEATEPWGVMVERVEI------KDVSLPVSMQRAMAAEAEAARDARAK--------VIAAEGE 261
            .|.|....:|::::.:.|      ::.:..|.|::....|||.||....|        |..|||:
 Worm   156 ALRERAAQFGLLLDDIAITHLNFGREFTEAVEMKQVAQQEAEKARYLVEKAEQMKIAAVTTAEGD 220

  Fly   262 KKSATALKEASDVISASPSALQLRYLQTLSSISAE--KNSTIIFPLP 306
            .::|..|.:|  ..||....::||.::....|:..  ||..:.: ||
 Worm   221 AQAAKLLAKA--FASAGDGLVELRKIEAAEEIAERMAKNKNVTY-LP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 36/162 (22%)
SPFH_like 107..314 CDD:302763 54/230 (23%)
phb-1NP_490929.1 PHB 29..190 CDD:214581 37/163 (23%)
SPFH_prohibitin 30..220 CDD:259799 46/193 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.