DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and STOML3

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_660329.1 Gene:STOML3 / 161003 HGNCID:19420 Length:291 Species:Homo sapiens


Alignment Length:263 Identity:150/263 - (57%)
Similarity:196/263 - (74%) Gaps:1/263 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QQYRGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGRLSGG-ARG 112
            |....|....|:..|...|::...|.|:.|||.||:|::|.|::.|||||::|||||:... |:|
Human    11 QDKENFVGVNNKRLGVCGWILFSLSFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKG 75

  Fly   113 PGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDYSMST 177
            ||:..:|||||.:.||||||||.|:|.||:||:||||..||.||||||...:.||..|.|...:|
Human    76 PGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQAT 140

  Fly   178 RLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQRAMA 242
            .|||.|||||::||:.||::|..||.:||::|..||:|||.||:.|.|||||||.:||.:||:||
Human   141 FLLAQTTLRNVLGTQTLSQILAGREEIAHSIQTLLDDATELWGIRVARVEIKDVRIPVQLQRSMA 205

  Fly   243 AEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIFPLPM 307
            |||||.|:|||||:|||||..::.:||.||.|::.||.|||||||||||:::.||||||:|||||
Human   206 AEAEATREARAKVLAAEGEMNASKSLKSASMVLAESPIALQLRYLQTLSTVATEKNSTIVFPLPM 270

  Fly   308 ELL 310
            .:|
Human   271 NIL 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 87/150 (58%)
SPFH_like 107..314 CDD:302763 125/205 (61%)
STOML3NP_660329.1 SPFH_like 73..271 CDD:327503 123/197 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 73 1.000 Domainoid score I9273
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.690

Return to query results.
Submit another query.